Loading...
HomeMy WebLinkAboutThe Clinton New Era, 1912-01-25, Page 6Page a 3 eneent ft- n ILLUSTRATED CATNLOODE :7.1z on .I.EQUEST 0,itt a errnell brotlefar 1.811.ori a ale]. Ninny a meal Wile ie dead ,tti the . evoeld, remaine urilturied. , , , „ At a tneetee, 0e Tact, most of our 1. There,e 'n, lot a biltuk verse -in the troueles atoonna to verydittle, ; life of tne ibv0.ittge poet. 011129,Mli nenenntena...... • enr" , 111 9oe'.5,, rt.4.0rnalOCI,SZIPtt nate Gnat aannien Itremedn. neues and treviatanteetheevanan ,,xtervires system, tualtue no* .Mentin old Voles, °Until Ntriqf Ors ,DOKay, „hirt,'Ittit? 0314 .73raa.T1707471, .1)00' pastioney, ,Neenzalealatees,.Emistrioms, $par. •inakirriataia, and Aneetnennalease lrooro,No, •Pritai per,por: siN.' for fea. One waleileaeo,sts Will O1P0., 'Sold 413, all ritioggists oz matiod In. plain pkg. on receipt of price, Nam pamphlet smiled. free.' 'rho ire4viietiv Wvatiae,v), L„ weit,tkaitab.finnitt ae" Tito Hind 7Cta I3-atnei etitittiran Ietletegint, and en;:eitc,t. its lateen in 'elan f oven C3',j,eitTS1 bets llozno tr.,s,.71-ttilre of neet.„,en and Inne Intern entettet nteden hie por- n- ?-- r4ioruil ni:j.w.ii"1`laitilt, I:11100 ii.15 beim/nee. ef4 Allow lo or. to to docent tee„yet el in this. Co mor re Ito, sitai tat:14)11g n`ntetenseetood" are hut Exporinnents that trifle "teelib ;end. entelemenat alto :health a Infants and Onildeacn---Expenience, cre,ahatit eneoritneatt. Whet CASTOR1 Clastoria ill a harmless entlentittente fore Castor Oil, Pare- goric, Dreeen and Etootitiiint Getrups, It it Pleasneet. It • Contains neltIter Onn rel'oentitteo or other nefaiitiatic substance. Ite ts gat' t destnoya IT -orlon and allays FecetelnitrectiO„ It ormete DInenelieetia nal Wind CoUc It neellenten 'Y.:en:tieing 'Troubles, ceencet Colnatipeetion.. anti& :rlatulency, Itaaelneilfetne tine itneed, regulates tbo Stott/mete mid_ Dowels, felling' ineennalay entil natural sleet). The Chtidnou's Pannecte.--.70.0 Mother's CP-iis=7•=i fx'N• • 7:'.•,'„) ,f1"0 G hl 8 gY it'sa. gvt ALWAJS *Lao Eigastrzo of ir c'ttrPeets' ‘:treafe C;•17 a0 4 Vatet_fteX The i-ndYoi ijcir Jimys Bought ) En Use For Over 30 Years. 71.10 CENTAUR COMPANY. 77 suanav 6700117. NSW vona cm& tvniatitiesne Valle t TAwFm.ITMEENEEHEINEM veneneareereenneve, With Every Bag of Flour There Goes A Guarantee That guarantee means that I believe Cream of the West to be the best bread flour on the rnaineet. If your bread doesn't beat any you ever baked before, if it fails to rise or doesn't give extra satisfaction in every way, your grocer will pay you back your money on return of the unused portion of the bag. tz'e. est lour 143121/0211=1191=1=2:EC.= 111M292:039111161211:2=10 1=6:1=S:=IMEIEMOCES=YD the hard Wheat flour guaranteed for bread 11 people will fairly and honestly try Cream of the West they will have success with it. That's why we guarantee it. We are sue of it. The Campbell Milling Company, Limited, Toronto ARCHIBALD CAMPBELL, ?residue( los gWaV/ "For Sale By - 11. Livens, Seaforth r • 15 MeneentetetTireinA ,Beacona an Smythe, Clinton. John Denholna, Blyth . - Head-on Collision Occurs on the Canadian Northeara ONE TRAINMAN IS KILLED Repair Train, Southbound, Dieregard a Orders and Crashes Into Passenger Train from Toronto . Neer Lake : Joseph -V. Hudson, a Fireman, on the Latter, Is Killed and Three Others are .1 njUred. ., Toronto, Jan. 22.--•A hettetten colli- sion be !weed a passenger and a freight , train on the C. N. O., two miles south of Lake Joseph, at mileage 728 1-2, on Saturday afternoon, caus- ed the death of one trainman and the serious injuey of three, ahem A. repair train sonthliound to: clear the track of a freight wreck, disre- garded orders and collided with pas- senger train No. I from Toronto. W. Hudson, fireman mi the passenger ttain, was killed, and Engineer John -- stone of the auxiliary, EngMeer John Napier of the passenger, and Fireman Awde of the auxiliary were injured. The injured trainmem who are suffer- ing chiefly from scalp wounds, are re- ported to be resting easily. A. J. 'Hills, superintendent of the C.N.O., stated yesterday that although it is ,customary to give an auxiliary train right of way in the case of a very baci blockade, in this particular instanee the blockade was not of sun ficient importinnee to warrant a: step of this kind. The auxiliary, stated. the supeeintendent, should have side- ' tracked when it received orders to do 50, in eerier to let the passenger train by, but had evidently not uone so, Ithereby causing the collisiOn. The superintenneet yesterday issu- ed the following statetnent: • "Extra 279, southbound, collided Ibead -on with train NO. I, at mileage 128 1,2, at 4.72 p.m., 20th, due to the crew of the extra tram dieregarding running order of train No. 3. Fire- man W, Hudson was caught between the engine mid tender orthe north- bound train and died within ten Minutes; the eneineer eeeaped unhurt The erten riding in the southbound en- gine escaped with scalp wounds and bruises. No passengers were injured. A retief train evas rushed to the scene from Parry Sound and the injured transferred to that poiet. The steam crane is working clearing the line, and has made geed progress." It is further stated that the passen- ger train was late, but had made hp some of the time lost.: The auxiliary natal crew, not knowing this, had con- tinued on their way, and had expected , to make the next siding before its arrival. Notwithstanding the fact that the paesenger train 30311 traveling at 35 miles an hour, and the auxiliary train - at 20 milean hour, none of the pan 'senders were injured, and none of the coachee left the track. This was a very extraordinary, but torn/nate; oc- eurrence. Fireman Hadeon, the man killed, was caught between the engine and the tender. and badly ertiehed. Ile died within ten mit/fetes of being released. ;1. relict train 11110 melted to the enene erern Parry Soend. which is 20 fence north of the eeene of the !mei, dent. end the 1113111.51 removed to that point. Thoy are 1 eportA to be done: yrry well. The steam menet of the .13. (11.51). which was not ilitiongetl, 11a0 innuedietelY got Lo wark and the newt: cleared. Both eneinee me very delimited and will require con- ttrali:e repairs. but none of. tile : 1(3. 1'.'. were tidnI0freli tO any extent Electric Restorer for Men Ph osphonoi rostra every tier? in the lauds, vim and vitality. premartiuroriedre.eynsgdillrteLoareal weakness averted at once. Phospbonoi will make you a now man. Price 13110 box. or two for 05. fvfallecl to any address, The Seobelll Drug -43., St. Catharines. Ont. virinout this ad, and mail it now, We will send, by ITD your name and address in the lines above, clip return man, a book that tells how to make yours a "Twentieth Century" farm. , You wouldn't be satisfied to use a seYthe to cut your grain, when a modern harvester ean do it so much better, wotild you? Nor to use the old soft -iron plough -share that your ancestors walked behind, when you can get an up-to-date riding plough? Every Canadian farmer realizes the advantages of Twentieth Century implements, The next step is The 20th. Century Miterial—Conerete •• Concrete is as far ahead of brick, stone, or wood as the hiirvester is ahead of the scythe or the riding -Plough is ahead of the old Iron plough -share, Concrete is easily mixed, and easily placed. It resists heat and cold 1,8 no other material can; hence is best for 100-hou000, root- -cellars, barns, silos and homes. It never'needs repa,lr: therefore it makes ths best walks, fence -posts, culverts, drain -tiles, survey monuments, bridges and eulverth. It cannot burn; you can clea11 a concrete poultry -house by filling it with straw and setting the straw afire. 01ae lice, ticks and all germs win be burned, but Ole houee is uninjured. It 10 cheap --sand and gravel cart be taken from your own' e farm, Cement, the only material you must buy, forms from one-seventh to one-teuth of the whole V0111M0./ DO you want to know more about Concrete on the Farm? Then write yet= name and address in the lines above, or on a PoStcard, mail it to us, and you win receive by retuen mail a copy on "What the Farmer Can' o With Concrete" Not a catalogue, but a 1.6 eepage book, proftteely illustrated, explaining how you can use e.onerete on :YOUR farm., ADDRESS - CANADA CEMENT' CO., Ltd. c MODITILBAL NATIONAL BANH,BUILDING ,a Ail ELL,{, PresidV ent Falconer o'z' a Pleasant 1' Surprise and a 1 -tandem -fie Gift. T.'rtrit/ DAY, J RiVit,1,91g, vosirrt,s 'LEAACY,, • titheSeletitinic11411P,lorarlf`' • .WE „ EDS. . • rk „II Tarat nto 'Univers.y. re,eeived ite'in eorenervshesa-n•Le"Y. 'waagetting .ready 011"' yet . „oryfttot NOnenomoewea• reeebtlY, Prnsidente "Feleener 1.5111.001 11 one retie d' hes II clea le ft tit initton not lone ago to cave the , 7410 /130,;-C or itiarlder al Ny and, „. 11111' 1110.11 men who well 1 for 'Lite weinen who' tette Gin Pills, to catch a train, had Very little tiette Tlecatette, Gin Piils care-eon:tally and ' --111 his disnosal. A ' visitor wa.S. eompletelee, enne-evetty tracetof these . 1-1.Y,6119nd-11, DrirS. .1\40:tfleet, 01111 1) ttottblee.' , ' qUite' Unfamiliar • te 1711(1. . ,Tbe. President toll the intend . to asn • "710113 troubled with Inidney,Disease 'hey iT.,slie emeld 'not come t� 300 11(1 fee reveeal years: liky back was weak. /ater in the. weelt, However the lady liad 'terrible headaches; and was so 101011311 that 'ehe wanted to see 111111 re: nese that 1.503118 not sleep at night. Al. lard. a friend told me 'about Gin Pills. I, at once, got a box aud after taking them, I felt better -after taking three bones, I wee cured. UTHItIe 73ALCOMBE, Don't take substitutes. Ir your dealer won't supply you, send us the regular retail price -foe. a box, or 6 for $etso -and • we will forward Gin Pills by return mail. Money refunded if Gin Piths fan to give satisfaction. Sample)», free if you write National Drug & nhemicel Co, of Canada, Limited, Dept, A Toronto. 96 Hindus Pict Wanten. Hamilton, Jan. 22, -Admission nf Hindu laborers into Canada wait oppbsed in a resolution adopted by the Ilemilton Trades tmd Label. Coeur- cil Friday night. Copies of the rose.. lution will be Fent to the Gevernment lid Hartrilton's representatives in Parliament. ; Coleridge' as Conversationalist, Coleridge 10110 a prodigiona tenter, end hie fluency and eloquence in die- fussion mem brought his fellow de- baters to a standstill. Edward Irving onec eomplained to a fellow guent at eta 01 llmantee . "Con you ever get a wad m wth Conning° ?" "No," Was the 'reply; "ner de utiiih. to.- • There is a story of Coleridge's bon fennel/lig .Hazlitt in the- Greve and eubjecting him to a streem 11 51000- ('13". The latter was preeeed for time, but •waited ;ill his patience he., eume exhausted; 1113.501 lia ctit oit the button end fled„ leaving, • Coieridg,e te diseeeree Ir, it at leisure, aulchly stops coughs, cures colds, heals the throot and hinds • 1115 cents. - High Power Microspopy. There has been exhibited before the Itoyal Society of London a form Of microscope, the invention. of Prof. Gordon, by neeens of Which emir/none magnification of an object tem, it is slated, he attained without the Wenn ishes due to optinal onuses that 'for- merly inarred such images. saye Men pern Weekly. We inay suppose that the- enlarged imege of an object is received from a microscope lens upon a ground -glees focusing sateen, .rued that then .anotin ed microscope is employed still further ID enlarge the image so formed. This o'i course, quite feasible, but the grain o.fethe glass would be magnified together with the image and woula vitiate the result. Prof. Gordon 1160S O trans.l.tecent screen of .the finest poen sible -texture, and he Causes it to he kept in 'continual Motion while the object is .being viewed or .photograph- ed. By this means the grain of the sereen is eliminated and the great.‘ magnified image at the object alone scien. Specimens magnified to the ex. tent of ten thousand diametees were shown as proof or the eflicacy of the method adopted. Jenny. Lind's Charm. Tho furnivereary of the death of J)'11117 Idnd calls to mind a meet lov. able and charming perifonality. 'Ibe Infirmary at Norwich. named afn r her, "The jermy Lind lefirmary," was founded fifty-eight yeare age by her. She evELS 0110 oi the enet neet singers that "ever poured tet,iu world flood of Itermonya find among other of the great men et ler tittle who apprecieted her at :er right value Was Itt enneleenlin 110 said of lien "She is 110 areal, an at- ist as ever lived, and tile greete f have hnown." For a long lime -he lived in Kensington, at Cleire ile Glenna in a pretty one -storied cot: 40, over whinh grow a tine magnolia. A .criti 0 wrote of 1101, ail or slic had nine for some years hi rend opera, no l 11 she hael not been the en:if:met eie for in the wend, sln would have lii C.; the greatest netrese." Wome N ed sympathy' and help when they dre attacked by weaknessand suffering: At timee when Nature seems. cruel. and very' harcle-.ewhen depressions ,and derangeinents come —kind wqmanlyfriendstilaniveeympathy. When ailments ocenr, ;the beet natural help and correction is 'the eafe and wellttried, family ,remetly They emrect the result' of ezeers and remove the ciliate of, suffenng. They, have tonic, helpful action on the whole system. They entleve nervousness, headache, backaehet dispel dePreesion., and suffering. Peecha.re's Tills give 'the orgatte strength, improve bodily condnions and may be relied upon or re '.e Per females, tleecham's aro spe, euitable. See inatructione with each Sold pvequtere. • In biaxi then and now. "I'v Penne a thouslind mik01 te meet the pi:aside/it of To. 17niversitet.”. said she. •So president Falconer went down to -the reception Morn to interview his viSiton The lady, explained that she was ail American, whose husband had died recently, "My hiesbandn' erne] ,she, "was during his lifetiMe greatly interested in Canada, and wee particularly impressed with the fine work being done by the -University of Toronto, He followed its progreee with the deepest interest and often expressed the wish, tha,t he meld do semething to associate his name with iC He died intestate, but, knowing his wishes ia the matter, I want to offer you some money, which migan be used in any way yen thought well to perpetuate 11I11 memory in your university. Will you accept $5,000i' The president promised to lay the matter before -the board okgovernors, assuring her that the board would hardly ha likely to refuse so generous an offer. It has been &Meted that the money tdrue romantically donated shell be used. to found a lectureship to be known as the Pearson-Kirkman- Marfleet lectureship. Every three years some prominent men, prefeert- bly an American, will be secured to deliver a series of lectures on some Phase of public or international life. The first lecture 1.51,11 probably he given. neat year. only Enough For One. Sheridmi wasonce staying at the house of an .ekterly maiden lady in the country, who Wallte(.1 111010 of Me company than he 10:18 willing to give: Proposing one day to take a steoll with him, the excused himself on account of the badness of the weather. Shortly afterward she met him sneaking, out, alone. t'So, "Mr. -Sheridan," said she, "it has (neare(1 up." "Just a 1i111&',- madam -enough for one, but not 33)1031)411 for two." Cleverer Than He. The confirmed bachelor came back to the club lamb from the end of the tfarth, and we all atiked him 11 110 15110 married (he is nearly fifty). "1 shall marry a CleV01 1001111111. if I do," he replied grimly. "Thought you didn't like those clever women," said the youngeet member simply. "I don't," said the bacheler, whotie views are well known and tvidely *read, "But 0 ever 1 marry it'll be an internally clever W0131all 10110 dove it," -London Chronicle. Children Cry FOR FLETCHER'S °ASTORIA Had Palpitation of the Heart Weakness ant l Choking Spells. When the heart begins to beat irregu- larly, palpitate and throb, beats fast for a time, then so slow as to seem almost to stop, it causes great anxiety and alarm. When the heart does this many people are kept in a state of morbid fear of death, and become weak, worn and miscra.ble. To all such eulferers Milbura's Heart and Nerve Pill'ill give prompt and permanent relief. Mrs. John J. Downey, New Glasgow, N.S., writes: -"Just a fe.w lines to let you know what '.-our Milburn's Heaun, and Nerve Pills have done for me, a. was troubled with weakness and palpi- tation of the heart, would have severe choking spells, and could scarcely lie down at all. I tried many remedies, bat got none to answer my ease like yeur Pills; 7 can recommend them highlyno all having heart or nerve troubles." Price 50 cents per box, or 3 boxes for 91,25. Per sale at all dealers or wil1 be mailed direct on receipt of price by The 1'. Milburn Co., Limited, Toronto, Out. Conscious of Rectitude. "315i15 C0/0,Cia reeti," having been one of the omotations used in a lot- t.r published in the Canadien 110100- , .7P years ,neee, by for. Mc- Micken, M.te.., a prominent politician, addrented to the Hon. George Browne a political opponent accused the filet mentioned member el Parliament et having stolen 11 from a shoemaker's sign, and told the following story of it. In a certain English country - •town, where rival shoemakers erelifel their reepective trades on the LC010 street, immediately opposite eneh other, one of thene hit upon the elfin cf attracting notice to his beetnese hy placing the above quotation 1)11 the sign .ovcr his door, above the Words "John Brown, shoemaker." Ctretemers flocked to his shop if; goodly numbers, which the rival ehoemaner aeross the way ettrilened largely to the merit of the uneeeel inscription on the sign.' He finally' managed, as he thought, to go min better than his nivel, by placing (Writ MS (MU shop door the inscription, "ttelerns ,and woMeins consent. recti," • ‘Alwaye On Hie Job. Mr. Allen. Studhohne, the Labor member fonEast Hamilton, is one of the most faithful remesentatives 111 the local Legislature. He appaeently feels -that he ie not doing leis duty by his constituente unless he remains in his place lilee a watch dog, ready to bark whenever he gets an oppoetimity. Nothing will tempt him to leave. It is eine' that during the eecent session he was invited to a dinnee, but it was after the Legislature had started to sit at night, so he eould not go. "I cannot veey well be away," he, said, "one can never tell ,evhen tney enighttrusle in some unexpected legis- lation and put it through, so I do not want to be absent." . te,Tne rnan 'to Whorantifhe.'reMank was, G,flflI UP ALL HOPE RavrEnn3. PLgpRri, Q,, May e; 1.910. "I look upon my recovery as nothing shdrt of at miracle. I was for eleven years, constantly eufferingfrom Chronic: Dyspepsia. and Indigestion. I was treated by several doctor4 and they eimply did me no good. Dining the latter part of my illnees, I was tie thin that 7 'weighed only ere pounds, seed vomited everything I ate, • The doctors gave Inc up to die as the stomach trouble produced heart Weak- ness and I was frequently unconscious. I received the Last Rites Of The Church. At this titue, a lady strongly urged me to try 'Fruit-a-tives'. When I had taken one box, I west/mai better and after three boxes, I was practically well again, and had gained 20 pounds. I have taken 53 boxes in all and now weigh xect pounds and am well," Madame ARTHUR TOURANGAT.I. "riruit-a•tives" is the only medicine in the world made of intensified fruit juices and always cures Indigestion. eoc. a boa, 6 for $2.50, "or trial size, 25C. At all dealers, or from Fruit- a-tives Limited. Ottawa. 1111100 1110111,101104) 11 10 anotner ber and added, "But as a /nanny et fact, I have neyer known of his mice in the I -louse etopping ea bill from going through." . "Well, You see,". replied the Anal' "Studhohne thinks lie line lientene posterity if he keep, the bin beet. for half an hour." . Why He Applauden. 11. chaineteristic anecdote is told. at Cherubini, the most jealous of Ilie ir- liftable geom., of cometesers, He bail been prcivalled upon to be plies:nu :1 the lirst representation of tho 100 01: of a confrere. and during the first acts, t 17 111' lchbicule, h tweereizukcii.ntt Iaeingfitionounlei..y1 i The third act 1111.74 11).30 LIV0111.1)1y re- ceived, fend a. certain paseage inpeetal- ly seemed .M cast a coin blanket over the epectators, when till' 0 I 1111)51') r,,. to the astonishment of his Mende, was seen to epplaud heartily. "Do you 'really like thet due?" [(eked one of them. "I shonld have thought it eves one of the pooreat and coldest in the whole opera. "You idiot," answered the maestro, with genuine .neivele, "don't you see that if 1. did not a,ppland it he might possibty cut it out?" Children Cry FOR FLETCHER'S )ASTORIA Ito Pert and Impert 9;4 ffi Ato --- 7 A. W01011,11 is illa Itt 17,,s1, C101)c.1 Lye 011 ea eth -also the unfaireet. Are the people -who fell its not I o worry ebe iinimme olts,,s? TA ,9 rifle c0111411ti,vg(ii151 5013.'.S, 11e1t1.1 the 1'. '243 111,3 1., m: • . '53 143311S. The wee 01 the teeelefeeftseor le 11)11 11 3.1'hi.11 1)1.01.7i1 0?i,11 8115y 01000,1,', During the cm sus year in United States there were neaany seyentenseven thoesaun (teethe 110 to pricumento, and althougn consumrtion leads tins hy 62,000, pneumonia is responsible for inore clonOis thai diphtheria, soarlor fcver, smallpox, and- canner combined. The trouble is Um people arc loo cam. - less about colds -het them run .na-- mew bigger 01701i day -finally OM pneumonia steps in. Tbe very besi thing to keel. 111118)- in, every houSehrild Is Nor- -. 'Ohne, which you rein depend on for cOring colds, R affot:11. • •cortain reliefand a quick cure, I r I-uNA wi ,NS fnAciv, greater .1:Not C)117P • re,,vente,. • Q,4.9lichly pene,ratLig and ig de G'S i s,t, curat i Tv 310071 than any other linimeet. ena....e.. ne. W11.011 a cold is start- ripa. • give the chest ii/;1- . and throat 44, 'vigor' 1 ous Muni rubbing 1 -with Nerviline, ' gargle the throat with Nerviline, end fake at good stiff dose in het wafter, All's fan in love, 111 1.50,0 and in trying 3 you'll be surprtsed to dispose of 01111131 year's automobile. hove feet the add . '.. -I will 1115117P050. _ Ot course the &hest should 01 protected by a Nerviltne Porous! Piaster, whIch 'anti 6 absorb cult connestion and innearana- tion. You won't need '10 f00.)" „pneu- 1 menia, (3riime, Bronen tie, or Gold al/ uulckl stops canals, ewp Mad 12 Yen keen D arriiine bandy, on thfcan and 'nada THE TAINIXEI3 `‘HOP." How They "Trip ft" Inf .the Eaot End ' • 'of Old 1-unnon. The young fellows and gird) tato Leragtilleem nt.la1shlicEsnlf?lIP0tiffe ;11cfnInciltreigmplitaltios disgatee then. 'intentions, They are there 'for a romp and as much, fun aa they earl extract fer their sixpence. Nor is Bee molter ol the. cerernonlea intrY severe, so long tie he elan Inalte- ' ""bit" alter all is paid. Bunning: a , sixpenny 0111(1000110. 113 51 speculative undertaking,. A fine night or a rival attraction may draw away .all but the , habitnaledancers, and the reneipts.wm be soarcialn" sufficient to pay foe the , band, to say nothing of the cost of hir• ' ing the hall, lightieg, printing, rq,, freshet:lents, earl other items. In the superior anneepliere of.:a shilling ball one OCcaiiionallY sees dancers in evening dress, but aer any. one other than the M.C. to appear at ' a sixpenny cinderella i11 garments more ambitions than his 'Sandal , bet"lootecteveputiloclu gain for that, dancer a They -won't.stand "'side" or affecta- non of any kind at tanner" hops,'t Dancers need not tvear purnpe; though h.obnails, are barred, as a notice, free (meetly to be seen on the 0101111-000m walls, warns the thoughtless; but even those iron-sheed disciples of the 'terp- sichorean art can hoerow slippers off the proprietor for a fee of tevopenee; As for the ladies, they seldom wear gloves, for this is supposed to be giv- lug oneeelf airs. The proprietor is usually the M.C.,; though on special oceasions, and to, help on the sale of the tickets, he ape ponateetwo of the most popular habi- tues as his honorary assistants. . Introductions are, of course, conside ered unnecessary ,As neon as a dance is announced, the fellow stalks acrofee to the girl who has taken his fancy, shouldere oft a rival who may be reek- , mg for her, and puts out his elbow. Neither speaks 11 the girl is agree- able, she -takes the.arm, and is whirl- ed off. 71 she prefer$ some other fel- low, she simply shakes her head, and the disappointed one has to make a rapid. choice amongst the imehosen denesels. Having thus broken the iee, the fel- low is entitled to talk to the girl.. both during the dance and afterwards, Midway in tho evening the MCI. in- variably gets behind a trestle -table aud dispenses ginger -beer, cakes, and colifee. Those dancers who seek re- fresh/nein of a *trolly/. order - and there are usually many of them -have to find it elsewhere. But at sixpenny einderellas it ie coneidered very bad fornt if the fellow deeming with a girl immediately before the interval is 010- 1 1101)1)00(1 does not "stand treat" for her. If he ie favored with the last dance of the evening., too, he is en. titled te ante if he nine see the fade dameel to her 'tonic. As a rule, however, the frequenters of tanner "hope" have their little eliques, forming- their own figure sets, and chousieg their partners from fanonent themselves, though etherwise they are not eneuelable. Anel they all dance with spirit and zetn, The program is invariably made up of waltzes, lancers, and twe-steps; but the band have to perform to cmick time, or else they hear of it, Round the dancers go in all sorts of sityles- see-eawing tend hopping and. sliding - it doesn't matter how, so long as they get round -and innariably whistling or singing the catchy refrains that are played. Should a couple cannon another cou- ple, there is a cheery cry on "Mind your corns!" or "Sorry, old s,portl" and away they go, bumping 01/11 twist- ing and laughing till the striking of the last chord. 31, is physical exercise all the time in an East End dancing hall. 'n• Leeds Pottery. 'Leeds is probably the most cosme- politan centre of industry in all Eng- land, that of pottery being the most ancient. This indueery rose to some eminence at one period, both in. re- gard to domestic and ornamental wane of the white filigree oreler, but now the only branch .which .reniailes is a that of artistac majolica, in which we find real weeks of art in the choicest of designs and coloring. Such produc- tions, worthy of special note, are the flower vases mut pedestals for the earne, small \Niece and other orna- ments, and 1.1 is doubtful if either the Moore, who founded this industry, or the Italians, who developed it, produc ed anything superior to the' modern pottery front Leedn-Consular ate - ports. Welshmen to Foregather. Welshmen from all parte ef the world, 10311 1)0 present at the invent, tore el the Prince of Wales et Car- narvon, Already men in Australia., in the Far E1181, in South and in Egypt, and in Nerth • end South America have announced • their inten- tion of returning to the land of their httliers in order to join with the stay- nt-horne Welshmen in the illy 0830111- 11101, The holding ei the National 1115 tdd!oi1 almost immediately after the turestiture will help to swell the tide of the invasion. Twice Regained Sight. Most unueual were the experiences of George Vaughan, it Northampton grocer who died recently. He recover- ed his sight twice under 1701110 rkable eirettmetences. Wben be was entirel7. blind five years ego lie11111 11110 a pit- .lar-b(ik and after the shook he 3011.5 able to see for some time. He lost his sight ;Wain., however, and ha need to walk ebout with a dog to guide him. On his death -bed recioyered hie vita= sufficiently to Ince:mini the membere of his family, To Make Gaiway a Pert. A project to make trans- atlantic port, with eer- vice. for mane, }mese/mein and ether 4)1111111(1111'2,0 m 01'11 eet-, 1.4t a the 31 11)111)31 ann cereet eneetera ltainvey, of: 11-11 -1/! et Dablin Twen- ty thousand peunde is, needed for the preinotien of the scheme in Parlia- ment,,,ad the railway company atgre ed .130 'guarpartee 0,000 of it. Siinflter, ennis have 'b.een guaranteed by three sJ cures colds, Iheals . • 23. cents',